Recombinant Human C10orf82 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C10orf82-1568H |
Product Overview : | C10orf82 MS Standard C13 and N15-labeled recombinant protein (NP_653262) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C10orf82 (Chromosome 10 Open Reading Frame 82) is a Protein Coding gene. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C10orf82 chromosome 10 open reading frame 82 [ Homo sapiens (human) ] |
Official Symbol | C10orf82 |
Synonyms | C10ORF82; chromosome 10 open reading frame 82; uncharacterized protein C10orf82; Em:AC016825.4; MGC33547; FLJ40268; |
Gene ID | 143379 |
mRNA Refseq | NM_144661 |
Protein Refseq | NP_653262 |
UniProt ID | Q8WW14 |
◆ Recombinant Proteins | ||
C10orf82-1568H | Recombinant Human C10orf82 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C10orf82-1785HF | Recombinant Full Length Human C10orf82 Protein, GST-tagged | +Inquiry |
C10orf82-447H | Recombinant Human C10orf82 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf82-8361HCL | Recombinant Human C10orf82 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C10orf82 Products
Required fields are marked with *
My Review for All C10orf82 Products
Required fields are marked with *