Recombinant Human C10orf82 Protein, GST-tagged
Cat.No. : | C10orf82-447H |
Product Overview : | Human C10orf82 full-length ORF ( NP_653262.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MEPSKTFMRNLPITPGYSGFVPFLSCQGMSKEDDMNHCVKTFQEKTQRYKEQLRELCCAVATAPKLKPVNSEETVLQALHQYNLQYHPLILECKYVKKPLQEPPIPGWAGYLPRAKVTEFGCGTRYTVMAKNCYKDFLEITERAKKAHLKPYEE |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C10orf82 chromosome 10 open reading frame 82 [ Homo sapiens ] |
Official Symbol | C10orf82 |
Synonyms | C10ORF82; chromosome 10 open reading frame 82; uncharacterized protein C10orf82; Em:AC016825.4; MGC33547; FLJ40268; |
Gene ID | 143379 |
mRNA Refseq | NM_144661 |
Protein Refseq | NP_653262 |
UniProt ID | Q8WW14 |
◆ Recombinant Proteins | ||
C10orf82-1568H | Recombinant Human C10orf82 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C10orf82-1785HF | Recombinant Full Length Human C10orf82 Protein, GST-tagged | +Inquiry |
C10orf82-447H | Recombinant Human C10orf82 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf82-8361HCL | Recombinant Human C10orf82 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf82 Products
Required fields are marked with *
My Review for All C10orf82 Products
Required fields are marked with *
0
Inquiry Basket