Recombinant Full Length Human C5orf51 Protein, GST-tagged
| Cat.No. : | C5orf51-2677HF |
| Product Overview : | Human C5orf51 full-length ORF (NP_787117.3, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 294 amino acids |
| Description : | C5orf51 (Chromosome 5 Open Reading Frame 51) is a Protein Coding gene. |
| Molecular Mass : | 60 kDa |
| AA Sequence : | MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C5orf51 chromosome 5 open reading frame 51 [ Homo sapiens ] |
| Official Symbol | C5orf51 |
| Synonyms | C5ORF51; chromosome 5 open reading frame 51; UPF0600 protein C5orf51; LOC285636; |
| Gene ID | 285636 |
| mRNA Refseq | NM_175921 |
| Protein Refseq | NP_787117 |
| UniProt ID | A6NDU8 |
| ◆ Recombinant Proteins | ||
| C5orf51-0097H | Recombinant Human C5orf51 Protein, GST-Tagged | +Inquiry |
| C5orf51-1862H | Recombinant Human C5orf51 Protein, MYC/DDK-tagged | +Inquiry |
| C5orf51-2677HF | Recombinant Full Length Human C5orf51 Protein, GST-tagged | +Inquiry |
| C5orf51-5699H | Recombinant Human C5orf51 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C5orf51-252HCL | Recombinant Human C5orf51 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf51 Products
Required fields are marked with *
My Review for All C5orf51 Products
Required fields are marked with *
