Recombinant Human C5orf51 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C5orf51-5699H
Product Overview : C5orf51 MS Standard C13 and N15-labeled recombinant protein (NP_787117) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C5orf51 (Chromosome 5 Open Reading Frame 51) is a Protein Coding gene.
Molecular Mass : 33.4 kDa
AA Sequence : MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C5orf51 chromosome 5 open reading frame 51 [ Homo sapiens (human) ]
Official Symbol C5orf51
Synonyms C5ORF51; chromosome 5 open reading frame 51; UPF0600 protein C5orf51; LOC285636;
Gene ID 285636
mRNA Refseq NM_175921
Protein Refseq NP_787117
UniProt ID A6NDU8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C5orf51 Products

Required fields are marked with *

My Review for All C5orf51 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon