Recombinant Human C5orf51 Protein, GST-Tagged
| Cat.No. : | C5orf51-0097H | 
| Product Overview : | Human C5orf51 full-length ORF (NP_787117.3, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | C5orf51 (Chromosome 5 Open Reading Frame 51) is a Protein Coding gene. | 
| Molecular Mass : | 60 kDa | 
| AA Sequence : | MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | C5orf51 chromosome 5 open reading frame 51 [ Homo sapiens ] | 
| Official Symbol | C5orf51 | 
| Synonyms | C5ORF51; chromosome 5 open reading frame 51; UPF0600 protein C5orf51; LOC285636; | 
| Gene ID | 285636 | 
| mRNA Refseq | NM_175921 | 
| Protein Refseq | NP_787117 | 
| UniProt ID | A6NDU8 | 
| ◆ Recombinant Proteins | ||
| C5orf51-0097H | Recombinant Human C5orf51 Protein, GST-Tagged | +Inquiry | 
| C5orf51-5699H | Recombinant Human C5orf51 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| C5orf51-1862H | Recombinant Human C5orf51 Protein, MYC/DDK-tagged | +Inquiry | 
| C5orf51-2677HF | Recombinant Full Length Human C5orf51 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C5orf51-252HCL | Recombinant Human C5orf51 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf51 Products
Required fields are marked with *
My Review for All C5orf51 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            