Recombinant Human C5orf51 Protein, GST-Tagged

Cat.No. : C5orf51-0097H
Product Overview : Human C5orf51 full-length ORF (NP_787117.3, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C5orf51 (Chromosome 5 Open Reading Frame 51) is a Protein Coding gene.
Molecular Mass : 60 kDa
AA Sequence : MAAAVSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLLCGEEKECSNPSNLLELYTQAILDMTYFEENKLVDEDFPEDSSSQKVKELISFLSEPEILVKENNMHPKHCNLLGDELLECLSWRRGALLYMYCHSLTKRREWLLRKSSLLKKYLLDGISYLLQMLNYRCPIQLNEGVSFQDLDTAKLLSAGIFSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C5orf51 chromosome 5 open reading frame 51 [ Homo sapiens ]
Official Symbol C5orf51
Synonyms C5ORF51; chromosome 5 open reading frame 51; UPF0600 protein C5orf51; LOC285636;
Gene ID 285636
mRNA Refseq NM_175921
Protein Refseq NP_787117
UniProt ID A6NDU8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C5orf51 Products

Required fields are marked with *

My Review for All C5orf51 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon