Recombinant Full Length Human C6orf136 Protein, GST-tagged

Cat.No. : C6orf136-2688HF
Product Overview : Human C6orf136 full-length ORF (NP_659466.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 172 amino acids
Description : C6orf136 (Chromosome 6 Open Reading Frame 136) is a Protein Coding gene.
Molecular Mass : 46.9 kDa
AA Sequence : MEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAHLRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLMPSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C6orf136 chromosome 6 open reading frame 136 [ Homo sapiens (human) ]
Official Symbol C6orf136
Synonyms C6orf136; chromosome 6 open reading frame 136; uncharacterized protein C6orf136; Chromosome 6 Open Reading Frame 136
Gene ID 221545
mRNA Refseq NM_001109938
Protein Refseq NP_001103408
UniProt ID Q5SQH8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C6orf136 Products

Required fields are marked with *

My Review for All C6orf136 Products

Required fields are marked with *

0
cart-icon