Recombinant Full Length Human C6orf136 Protein, GST-tagged
| Cat.No. : | C6orf136-2688HF |
| Product Overview : | Human C6orf136 full-length ORF (NP_659466.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 172 amino acids |
| Description : | C6orf136 (Chromosome 6 Open Reading Frame 136) is a Protein Coding gene. |
| Molecular Mass : | 46.9 kDa |
| AA Sequence : | MEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAHLRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLMPSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C6orf136 chromosome 6 open reading frame 136 [ Homo sapiens (human) ] |
| Official Symbol | C6orf136 |
| Synonyms | C6orf136; chromosome 6 open reading frame 136; uncharacterized protein C6orf136; Chromosome 6 Open Reading Frame 136 |
| Gene ID | 221545 |
| mRNA Refseq | NM_001109938 |
| Protein Refseq | NP_001103408 |
| UniProt ID | Q5SQH8 |
| ◆ Recombinant Proteins | ||
| C6orf136-2688HF | Recombinant Full Length Human C6orf136 Protein, GST-tagged | +Inquiry |
| C6orf136-2402H | Recombinant Human C6orf136 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C6orf136-0107H | Recombinant Human C6orf136 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C6orf136-7995HCL | Recombinant Human C6orf136 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C6orf136 Products
Required fields are marked with *
My Review for All C6orf136 Products
Required fields are marked with *
