Recombinant Human C6orf136 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C6orf136-2402H |
Product Overview : | C6orf136 MS Standard C13 and N15-labeled recombinant protein (NP_659466) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C6orf136 (Chromosome 6 Open Reading Frame 136) is a Protein Coding gene. Diseases associated with C6orf136 include Spinocerebellar Ataxia, Autosomal Recessive 8 and Central Nervous System Germ Cell Tumor. |
Molecular Mass : | 20.5 kDa |
AA Sequence : | MEEHLSVMYERLRQELPKLFLQSHDYSLYSLDVEFINEILNIRTKGRTWYILSLTLCRFLAWNYFAHLRLEVLQLTRHPENWTLQARWRLVGLPVHLLFLRFYKRDKDEHYRTYDAYSTFYLNSSGLICRHRLDKLMPSHSPPTPVKKLLVGALVALGLSEPEPDLNLCSKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C6orf136 chromosome 6 open reading frame 136 [ Homo sapiens (human) ] |
Official Symbol | C6orf136 |
Synonyms | C6orf136; chromosome 6 open reading frame 136; uncharacterized protein C6orf136 |
Gene ID | 221545 |
mRNA Refseq | NM_145029 |
Protein Refseq | NP_659466 |
UniProt ID | Q5SQH8 |
◆ Recombinant Proteins | ||
C6orf136-0107H | Recombinant Human C6orf136 Protein, GST-Tagged | +Inquiry |
C6orf136-2688HF | Recombinant Full Length Human C6orf136 Protein, GST-tagged | +Inquiry |
C6orf136-2402H | Recombinant Human C6orf136 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C6orf136-7995HCL | Recombinant Human C6orf136 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C6orf136 Products
Required fields are marked with *
My Review for All C6orf136 Products
Required fields are marked with *
0
Inquiry Basket