Recombinant Full Length Human CA14 Protein, GST-tagged
| Cat.No. : | CA14-2737HF |
| Product Overview : | Human CA14 full-length ORF (NP_036245.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 337 amino acids |
| Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 64.1 kDa |
| AA Sequence : | MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CA14 carbonic anhydrase XIV [ Homo sapiens ] |
| Official Symbol | CA14 |
| Synonyms | CA14; carbonic anhydrase XIV; carbonic anhydrase 14; CA-XIV; carbonic dehydratase; carbonate dehydratase XIV; CAXiV; |
| Gene ID | 23632 |
| mRNA Refseq | NM_012113 |
| Protein Refseq | NP_036245 |
| MIM | 604832 |
| UniProt ID | Q9ULX7 |
| ◆ Recombinant Proteins | ||
| CA14-2485H | Recombinant human CA14, His-tagged | +Inquiry |
| CAR14-2716M | Recombinant Mouse CAR14 Protein | +Inquiry |
| CA14-0236H | Recombinant Human CA14 Protein, GST-Tagged | +Inquiry |
| CA14-118H | Recombinant Human CA14 Protein, His-tagged | +Inquiry |
| Car14-822M | Active Recombinant Mouse Car14 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CA14-2802HCL | Recombinant Human CA14 cell lysate | +Inquiry |
| CA14-3064MCL | Recombinant Mouse CA14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA14 Products
Required fields are marked with *
My Review for All CA14 Products
Required fields are marked with *
