Recombinant Full Length Human CABYR Protein, GST-tagged

Cat.No. : CABYR-2804HF
Product Overview : Human CABYR full-length ORF (NP_619585.1, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 379 amino acids
Description : To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2013]
Molecular Mass : 67.5 kDa
AA Sequence : MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CABYR calcium binding tyrosine phosphorylation regulated [ Homo sapiens (human) ]
Official Symbol CABYR
Synonyms CABYR; calcium binding tyrosine phosphorylation regulated; CT88; FSP2; CBP86; FSP-2; CABYRa; CABYRc; CABYRe; CABYRc/d; calcium-binding tyrosine phosphorylation-regulated protein; calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2); calcium-binding protein 86; cancer/testis antigen 88; fibrousheathin II; fibrousheathin-2; testis tissue sperm-binding protein Li 84P; testis-specific calcium-binding protein CBP86; Calcium Binding Tyrosine Phosphorylation Regulated; Cancer/Testis Antigen 88; Testis-Specific Calcium-Binding Protein CBP86; Calcium-Binding Protein 86; Fibrousheathin II; Fibrousheathin-2; Calcium Binding Tyrosine-(Y)-Phosphorylation Regulated (Fibrousheathin 2); Calcium-Binding Tyrosine Phosphorylation-Regulated Protein; Calcium Binding Tyrosine-(Y)-Phosphorylation Regulated; Testis Tissue Sperm-Binding Protein Li 84P; Fibrousheathin 2
Gene ID 26256
mRNA Refseq NM_001308231
Protein Refseq NP_001295160
MIM 612135
UniProt ID O75952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CABYR Products

Required fields are marked with *

My Review for All CABYR Products

Required fields are marked with *

0
cart-icon
0
compare icon