Recombinant Full Length Human CADPS Protein, GST-tagged
Cat.No. : | CADPS-3044HF |
Product Overview : | Human CADPS full-length ORF (AAH15754.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 222 amino acids |
Description : | This gene encodes a novel neural/endocrine-specific cytosolic and peripheral membrane protein required for the Ca2+-regulated exocytosis of secretory vesicles. The protein acts at a stage in exocytosis that follows ATP-dependent priming, which involves the essential synthesis of phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 52.1 kDa |
AA Sequence : | MFNVMVDAKAQSTKLCSMEMGQEFAKMWHQYHSKIDELIEETVKEMITLLVAKFVTILEGVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVADAYVTFVRHSQDVLRDKVNEEMYIERLFDQWYNSSMNVICTWLTDRMDLQLHIYQLKTLIRMVKKTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATASVSEGGGLQGISMKDSDEEDEEDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CADPS Ca++-dependent secretion activator [ Homo sapiens ] |
Official Symbol | CADPS |
Synonyms | CAPS; CAPS1; CADPS1 |
Gene ID | 8618 |
mRNA Refseq | NM_183394 |
Protein Refseq | NP_899631 |
MIM | 604667 |
UniProt ID | Q9ULU8 |
◆ Recombinant Proteins | ||
CADPS-580H | Recombinant Human CADPS Protein, His/GST-tagged | +Inquiry |
CADPS-0283H | Recombinant Human CADPS Protein, GST-Tagged | +Inquiry |
CADPS-10654H | Recombinant Human CADPS, GST-tagged | +Inquiry |
CADPS-1083R | Recombinant Rat CADPS Protein | +Inquiry |
CADPS-3044HF | Recombinant Full Length Human CADPS Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CADPS Products
Required fields are marked with *
My Review for All CADPS Products
Required fields are marked with *