Recombinant Full Length Human CANX Protein, C-Flag-tagged
Cat.No. : | CANX-1595HFL |
Product Overview : | Recombinant Full Length Human CANX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.3 kDa |
AA Sequence : | MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Antigen processing and presentation |
Full Length : | Full L. |
Gene Name | CANX calnexin [ Homo sapiens (human) ] |
Official Symbol | CANX |
Synonyms | CNX; P90; IP90 |
Gene ID | 821 |
mRNA Refseq | NM_001746.4 |
Protein Refseq | NP_001737.1 |
MIM | 114217 |
UniProt ID | P27824 |
◆ Recombinant Proteins | ||
CANX-2072D | Recombinant Dog Calnexin | +Inquiry |
CANX-12618Z | Recombinant Zebrafish CANX | +Inquiry |
CANX-492H | Recombinant Human CANX Protein, His (Fc)-Avi-tagged | +Inquiry |
CANX-3377H | Recombinant Human CANX protein, His-tagged | +Inquiry |
CANX-27552TH | Recombinant Human CANX | +Inquiry |
◆ Cell & Tissue Lysates | ||
CANX-1347HCL | Recombinant Human CANX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CANX Products
Required fields are marked with *
My Review for All CANX Products
Required fields are marked with *
0
Inquiry Basket