Recombinant Full Length Human Carbohydrate Sulfotransferase 1(Chst1) Protein, His-Tagged
Cat.No. : | RFL13569HF |
Product Overview : | Recombinant Full Length Human Carbohydrate sulfotransferase 1(CHST1) Protein (O43916) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLAEAGLAERLCEESPTFAYNLSRKTHILILATTRSGSSFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIKPPPVNHTTDRIFRRGASRVLCSRPVCDPPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLVRYEDLARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTVRNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNPSVSLVEERDFRPFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CHST1 |
Synonyms | CHST1; Carbohydrate sulfotransferase 1; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1; GST-1; Keratan sulfate Gal-6 sulfotransferase; KS6ST; KSGal6ST; KSST |
UniProt ID | O43916 |
◆ Recombinant Proteins | ||
CHST1-1403R | Recombinant Rat CHST1 Protein | +Inquiry |
CHST1-539H | Active Recombinant Human CHST1 Protein, His-tagged | +Inquiry |
CHST1-1294H | Recombinant Human CHST1 Protein, GST-Tagged | +Inquiry |
CHST1-691R | Recombinant Rhesus Macaque CHST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13569HF | Recombinant Full Length Human Carbohydrate Sulfotransferase 1(Chst1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST1-7509HCL | Recombinant Human CHST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST1 Products
Required fields are marked with *
My Review for All CHST1 Products
Required fields are marked with *
0
Inquiry Basket