Recombinant Human CHST1 Protein, GST-Tagged
Cat.No. : | CHST1-1294H |
Product Overview : | Human CHST1 partial ORF (NP_003645, 168 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHST1 carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 [ Homo sapiens ] |
Official Symbol | CHST1 |
Synonyms | CHST1; carbohydrate (keratan sulfate Gal-6) sulfotransferase 1; carbohydrate sulfotransferase 1; C6ST; KSGal6ST; carbohydrate (chondroitin 6/keratan) sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1; KSST; GST-1; KS6ST; |
Gene ID | 8534 |
mRNA Refseq | NM_003654 |
Protein Refseq | NP_003645 |
MIM | 603797 |
UniProt ID | O43916 |
◆ Recombinant Proteins | ||
CHST1-1294H | Recombinant Human CHST1 Protein, GST-Tagged | +Inquiry |
CHST1-1061R | Recombinant Rat CHST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHST1-11222H | Recombinant Human CHST1, GST-tagged | +Inquiry |
Chst1-751M | Active Recombinant Mouse Chst1 Protein, His-tagged | +Inquiry |
CHST1-865R | Recombinant Rhesus monkey CHST1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST1-7509HCL | Recombinant Human CHST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHST1 Products
Required fields are marked with *
My Review for All CHST1 Products
Required fields are marked with *
0
Inquiry Basket