Recombinant Human CHST1 Protein, GST-Tagged

Cat.No. : CHST1-1294H
Product Overview : Human CHST1 partial ORF (NP_003645, 168 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011]
Molecular Mass : 36.74 kDa
AA Sequence : PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHST1 carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 [ Homo sapiens ]
Official Symbol CHST1
Synonyms CHST1; carbohydrate (keratan sulfate Gal-6) sulfotransferase 1; carbohydrate sulfotransferase 1; C6ST; KSGal6ST; carbohydrate (chondroitin 6/keratan) sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1; KSST; GST-1; KS6ST;
Gene ID 8534
mRNA Refseq NM_003654
Protein Refseq NP_003645
MIM 603797
UniProt ID O43916

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST1 Products

Required fields are marked with *

My Review for All CHST1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon