Recombinant Human CHST1 Protein, GST-Tagged
| Cat.No. : | CHST1-1294H |
| Product Overview : | Human CHST1 partial ORF (NP_003645, 168 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This locus encodes a member of the keratin sulfotransferase family of proteins. The encoded enzyme catalyzes the sulfation of the proteoglycan keratin. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHST1 carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 [ Homo sapiens ] |
| Official Symbol | CHST1 |
| Synonyms | CHST1; carbohydrate (keratan sulfate Gal-6) sulfotransferase 1; carbohydrate sulfotransferase 1; C6ST; KSGal6ST; carbohydrate (chondroitin 6/keratan) sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1; KSST; GST-1; KS6ST; |
| Gene ID | 8534 |
| mRNA Refseq | NM_003654 |
| Protein Refseq | NP_003645 |
| MIM | 603797 |
| UniProt ID | O43916 |
| ◆ Recombinant Proteins | ||
| CHST1-1403R | Recombinant Rat CHST1 Protein | +Inquiry |
| RFL13569HF | Recombinant Full Length Human Carbohydrate Sulfotransferase 1(Chst1) Protein, His-Tagged | +Inquiry |
| CHST1-957Z | Recombinant Zebrafish CHST1 | +Inquiry |
| CHST1-1294H | Recombinant Human CHST1 Protein, GST-Tagged | +Inquiry |
| CHST1-865R | Recombinant Rhesus monkey CHST1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHST1-7509HCL | Recombinant Human CHST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST1 Products
Required fields are marked with *
My Review for All CHST1 Products
Required fields are marked with *



