Recombinant Full Length Human CASP1 Protein, GST-tagged
| Cat.No. : | CASP1-2921HF |
| Product Overview : | Human CASP1 full-length ORF (NP_150635.1, 1 a.a. - 311 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 311 amino acids |
| Description : | This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Mar 2012] |
| Molecular Mass : | 61.4 kDa |
| AA Sequence : | MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CASP1 caspase 1, apoptosis-related cysteine peptidase [ Homo sapiens ] |
| Official Symbol | CASP1 |
| Synonyms | CASP1; caspase 1, apoptosis-related cysteine peptidase; caspase 1, apoptosis related cysteine peptidase (interleukin 1, beta, convertase), caspase 1, apoptosis related cysteine protease (interleukin 1, beta, convertase), IL1BC; caspase-1; caspase 1; ICE; interleukin 1; beta; convertase; IL1B-convertase; CASP1 nirs variant 1; IL-1 beta-converting enzyme; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase); P45; IL1BC; |
| Gene ID | 834 |
| mRNA Refseq | NM_001223 |
| Protein Refseq | NP_001214 |
| MIM | 147678 |
| UniProt ID | P29466 |
| ◆ Recombinant Proteins | ||
| CASP1-1639H | Recombinant Human Caspase 1, Apoptosis-Related Cysteine Peptidase (interleukin 1, beta, convertase), His-tagged | +Inquiry |
| CASP1-174H | Recombinant Human CASP1 Protein, His-tagged | +Inquiry |
| CASP1-432H | Recombinant Human CASP1 protein, HA-tagged | +Inquiry |
| CASP1-1213H | Recombinant Human CASP1 Protein (Asn120-Asp297), N-His tagged | +Inquiry |
| CASP1-473P | Recombinant Pig CASP1 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASP1-7841HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
| CASP1-7840HCL | Recombinant Human CASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP1 Products
Required fields are marked with *
My Review for All CASP1 Products
Required fields are marked with *
