Recombinant Full Length Human CATSPERZ Protein, GST-tagged
| Cat.No. : | CATSPERZ-1799HF |
| Product Overview : | Human C11orf20 full-length ORF ( CAL37866.1, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 200 amino acids |
| Description : | Predicted to be involved in flagellated sperm motility; male meiotic nuclear division; and sperm capacitation. Located in cytoplasm and sperm principal piece. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 48.4 kDa |
| AA Sequence : | MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CATSPERZ catsper channel auxiliary subunit zeta [ Homo sapiens (human) ] |
| Official Symbol | CATSPERZ |
| Synonyms | TEX40; C11orf20 |
| Gene ID | 25858 |
| mRNA Refseq | NM_001039496.1 |
| Protein Refseq | NP_001034585.1 |
| MIM | 617511 |
| UniProt ID | Q9NTU4 |
| ◆ Recombinant Proteins | ||
| CATSPERZ-6346H | Recombinant Human CATSPERZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CATSPERZ-463H | Recombinant Human CATSPERZ Protein, GST-tagged | +Inquiry |
| Catsperz-1972M | Recombinant Mouse Catsperz Protein, Myc/DDK-tagged | +Inquiry |
| CATSPERZ-1799HF | Recombinant Full Length Human CATSPERZ Protein, GST-tagged | +Inquiry |
| CATSPERZ-650H | Recombinant Human CATSPERZ Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CATSPERZ Products
Required fields are marked with *
My Review for All CATSPERZ Products
Required fields are marked with *
