Recombinant Full Length Human CATSPERZ Protein, GST-tagged
Cat.No. : | CATSPERZ-1799HF |
Product Overview : | Human C11orf20 full-length ORF ( CAL37866.1, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 200 amino acids |
Description : | Predicted to be involved in flagellated sperm motility; male meiotic nuclear division; and sperm capacitation. Located in cytoplasm and sperm principal piece. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CATSPERZ catsper channel auxiliary subunit zeta [ Homo sapiens (human) ] |
Official Symbol | CATSPERZ |
Synonyms | TEX40; C11orf20 |
Gene ID | 25858 |
mRNA Refseq | NM_001039496.1 |
Protein Refseq | NP_001034585.1 |
MIM | 617511 |
UniProt ID | Q9NTU4 |
◆ Recombinant Proteins | ||
Catsperz-1972M | Recombinant Mouse Catsperz Protein, Myc/DDK-tagged | +Inquiry |
CATSPERZ-463H | Recombinant Human CATSPERZ Protein, GST-tagged | +Inquiry |
CATSPERZ-1799HF | Recombinant Full Length Human CATSPERZ Protein, GST-tagged | +Inquiry |
CATSPERZ-650H | Recombinant Human CATSPERZ Protein, MYC/DDK-tagged | +Inquiry |
CATSPERZ-6346H | Recombinant Human CATSPERZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CATSPERZ Products
Required fields are marked with *
My Review for All CATSPERZ Products
Required fields are marked with *