Recombinant Human CATSPERZ Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CATSPERZ-6346H
Product Overview : C11orf20 MS Standard C13 and N15-labeled recombinant protein (NP_001034585) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CATSPERZ (Catsper Channel Auxiliary Subunit Zeta) is a Protein Coding gene. Diseases associated with CATSPERZ include Hidradenoma.
Molecular Mass : 22.7 kDa
AA Sequence : MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CATSPERZ catsper channel auxiliary subunit zeta [ Homo sapiens (human) ]
Official Symbol CATSPERZ
Synonyms CATSPERZ; catsper channel auxiliary subunit zeta; TEX40; C11orf20; cation channel sperm-associated protein subunit zeta; catSper-zeta; catSperzeta; testis expressed 40; testis-expressed protein 40; testis-expressed sequence 40 protein
Gene ID 25858
mRNA Refseq NM_001039496
Protein Refseq NP_001034585
MIM 617511
UniProt ID Q9NTU4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CATSPERZ Products

Required fields are marked with *

My Review for All CATSPERZ Products

Required fields are marked with *

0
cart-icon
0
compare icon