Recombinant Human CATSPERZ Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CATSPERZ-6346H |
Product Overview : | C11orf20 MS Standard C13 and N15-labeled recombinant protein (NP_001034585) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CATSPERZ (Catsper Channel Auxiliary Subunit Zeta) is a Protein Coding gene. Diseases associated with CATSPERZ include Hidradenoma. |
Molecular Mass : | 22.7 kDa |
AA Sequence : | MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CATSPERZ catsper channel auxiliary subunit zeta [ Homo sapiens (human) ] |
Official Symbol | CATSPERZ |
Synonyms | CATSPERZ; catsper channel auxiliary subunit zeta; TEX40; C11orf20; cation channel sperm-associated protein subunit zeta; catSper-zeta; catSperzeta; testis expressed 40; testis-expressed protein 40; testis-expressed sequence 40 protein |
Gene ID | 25858 |
mRNA Refseq | NM_001039496 |
Protein Refseq | NP_001034585 |
MIM | 617511 |
UniProt ID | Q9NTU4 |
◆ Recombinant Proteins | ||
CATSPERZ-1799HF | Recombinant Full Length Human CATSPERZ Protein, GST-tagged | +Inquiry |
Catsperz-1972M | Recombinant Mouse Catsperz Protein, Myc/DDK-tagged | +Inquiry |
CATSPERZ-6346H | Recombinant Human CATSPERZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CATSPERZ-650H | Recombinant Human CATSPERZ Protein, MYC/DDK-tagged | +Inquiry |
CATSPERZ-463H | Recombinant Human CATSPERZ Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CATSPERZ Products
Required fields are marked with *
My Review for All CATSPERZ Products
Required fields are marked with *
0
Inquiry Basket