Recombinant Human CATSPERZ Protein, GST-tagged

Cat.No. : CATSPERZ-463H
Product Overview : Human C11orf20 full-length ORF ( CAL37866.1, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 48.4 kDa
AA Sequence : MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CATSPERZ catsper channel auxiliary subunit zeta [ Homo sapiens (human) ]
Official Symbol CATSPERZ
Synonyms TEX40; C11orf20
Gene ID 25858
mRNA Refseq NM_001039496.1
Protein Refseq NP_001034585.1
MIM 617511
UniProt ID Q9NTU4.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CATSPERZ Products

Required fields are marked with *

My Review for All CATSPERZ Products

Required fields are marked with *

0
cart-icon