Recombinant Full Length Human CCL2 Protein, C-Flag-tagged
Cat.No. : | CCL2-937HFL |
Product Overview : | Recombinant Full Length Human CCL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 infection. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 10.8 kDa |
AA Sequence : | MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV AKEICADPKQKWVQDSMDHLDKQTQTPKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | CCL2 C-C motif chemokine ligand 2 [ Homo sapiens (human) ] |
Official Symbol | CCL2 |
Synonyms | HC11; MCAF; MCP1; MCP-1; SCYA2; GDCF-2; SMC-CF; HSMCR30 |
Gene ID | 6347 |
mRNA Refseq | NM_002982.4 |
Protein Refseq | NP_002973.1 |
MIM | 158105 |
UniProt ID | P13500 |
◆ Recombinant Proteins | ||
CCL2-1211R | Recombinant Rat CCL2 Protein | +Inquiry |
CCL2-78H | Recombinant Human CCL2 | +Inquiry |
CCL2-2146C | Recombinant Cattle CCL2 Protein, His-tagged | +Inquiry |
CCL2-267H | Active Recombinant Human CCL2 Protein (Gln24-Thr99), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CCL2-1170H | Recombinant Human CCL2 Protein (Gln24-Thr99), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL2-001MCL | Recombinant Mouse CCL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL2 Products
Required fields are marked with *
My Review for All CCL2 Products
Required fields are marked with *
0
Inquiry Basket