Recombinant Rat Ccl2 protein, His-tagged

Cat.No. : Ccl2-02R
Product Overview : Recombinant rat CCL2/JE/MCP-1 protein (24-148aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Insect cells
Tag : His
Protein Length : 24-148 a.a.
Description : A monocyte chemoattractant protein.
Form : Liquid
Molecular Mass : 15.1 kDa
AA Sequence : QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Ccl2 C-C motif chemokine ligand 2 [ Rattus norvegicus (Norway rat) ]
Official Symbol Ccl2
Synonyms Ccl2; C-C motif chemokine ligand 2; MCP-1; Scya2; Sigje; C-C motif chemokine 2; chemokine (C-C motif) ligand 2; immediate-early serum-responsive JE protein; immediate-early serum-responsive protein JE; monocyte chemoattractant protein 1; monocyte chemotactic protein 1; small inducible cytokine A2; small inducible gene JE
Gene ID 24770
mRNA Refseq NM_031530
Protein Refseq NP_113718
UniProt ID P14844

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl2 Products

Required fields are marked with *

My Review for All Ccl2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon