Recombinant Rat Ccl2 protein, His-tagged

• Cat.No.: Ccl2-02R
• Product Overview: Recombinant rat CCL2/JE/MCP-1 protein (24-148aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Rat
• Source: Insect cells
• Tag: His
• Protein Length: 24-148 a.a.
• Description: A monocyte chemoattractant protein.
• Form: Liquid
• Molecular Mass: 15.1 kDa
• AA Sequence: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Ccl2 C-C motif chemokine ligand 2 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Ccl2
• Synonyms: Ccl2; C-C motif chemokine ligand 2; MCP-1; Scya2; Sigje; C-C motif chemokine 2; chemokine (C-C motif) ligand 2; immediate-early serum-responsive JE protein; immediate-early serum-responsive protein JE; monocyte chemoattractant protein 1; monocyte chemotactic protein 1; small inducible cytokine A2; small inducible gene JE
• Gene ID: 24770
• mRNA Refseq: NM_031530
• Protein Refseq: NP_113718
• UniProt ID: P14844