Recombinant Full Length Human CCL27 Protein, GST-tagged
Cat.No. : | CCL27-2947HF |
Product Overview : | Human CCL27 full-length ORF (NP_006655, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 112 amino acids |
Description : | This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 37.95 kDa |
AA Sequence : | MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL27 chemokine (C-C motif) ligand 27 [ Homo sapiens ] |
Official Symbol | CCL27 |
Synonyms | CCL27; chemokine (C-C motif) ligand 27; SCYA27, small inducible cytokine subfamily A (Cys Cys), member 27; C-C motif chemokine 27; ALP; CC chemokine ILC; CTACK; CTAK; cutaneous T cell attracting chemokine; ESkine; IL 11 Ralpha locus chemokine; ILC; PESKY; skinkine; IL-11 Ralpha-locus chemokine; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; small inducible cytokine subfamily A (Cys-Cys), member 27; ESKINE; SCYA27; |
Gene ID | 10850 |
mRNA Refseq | NM_006664 |
Protein Refseq | NP_006655 |
MIM | 604833 |
UniProt ID | Q9Y4X3 |
◆ Recombinant Proteins | ||
CCL27-3384H | Recombinant Human CCL27 protein(Phe25-Gly112), His-tagged | +Inquiry |
CCL27-517R | Recombinant Rhesus Macaque CCL27 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL27-53H | Recombinant Human CCL27 Protein | +Inquiry |
CCL27-67H | Recombinant Human CCL27 Protein, Biotin-tagged | +Inquiry |
CCL27-255H | Recombinant Human CCL27, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL27-302HCL | Recombinant Human CCL27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL27 Products
Required fields are marked with *
My Review for All CCL27 Products
Required fields are marked with *