Recombinant Full Length Human CD1D Protein
Cat.No. : | CD1D-64HF |
Product Overview : | Recombinant full length Human CD1d with N terminal proprietary tag; predicted MW 62.59 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 335 amino acids |
Description : | This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. |
Form : | Liquid |
Molecular Mass : | 62.590kDa inclusive of tags |
AA Sequence : | MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSS WTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQ WETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVN LAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVG FTSRFKRQTSYQGVL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD1D CD1d molecule [ Homo sapiens ] |
Official Symbol | CD1D |
Synonyms | CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d |
Gene ID | 912 |
mRNA Refseq | NM_001766 |
Protein Refseq | NP_001757 |
MIM | 188410 |
UniProt ID | P15813 |
◆ Recombinant Proteins | ||
CD1D-3515S | Recombinant Sylvilagus floridanus (Cottontail rabbit) CD1D, His-tagged | +Inquiry |
CD1D-828H | Recombinant Human CD1D Protein, Fc-tagged | +Inquiry |
CD1D-231H | Recombinant Human CD1D Protein, His-tagged | +Inquiry |
RFL31371HF | Recombinant Full Length Human Antigen-Presenting Glycoprotein Cd1D(Cd1D) Protein, His-Tagged | +Inquiry |
CD1D-27107TH | Recombinant Human CD1D | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1D-2479HCL | Recombinant Human CD1D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1D Products
Required fields are marked with *
My Review for All CD1D Products
Required fields are marked with *
0
Inquiry Basket