Recombinant Full Length Human CD209 Protein
Cat.No. : | CD209-3033HF |
Product Overview : | Human CD209 full-length ORF (NP_066978.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 359 amino acids |
Description : | This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.[provided by RefSeq, Feb 2009] |
Form : | Liquid |
Molecular Mass : | 45.8 kDa |
AA Sequence : | MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |
Applications : | Antibody Production Functional Study Compound Screening |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD209 CD209 molecule [ Homo sapiens ] |
Official Symbol | CD209 |
Synonyms | CD209; CD209 molecule; CD209 antigen; CDSIGN; CLEC4L; DC SIGN; DC SIGN1; HIV gpl20-binding protein; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin; DC-SIGN; DC-SIGN1; MGC129965; |
Gene ID | 30835 |
mRNA Refseq | NM_001144893 |
Protein Refseq | NP_001138365 |
MIM | 604672 |
UniProt ID | Q9NNX6 |
◆ Recombinant Proteins | ||
CD209-635H | Active Recombinant Human CD209 protein | +Inquiry |
CD209-0747H | Recombinant Human CD209 Protein | +Inquiry |
CD209-728R | Recombinant Rhesus CD209 protein, Fc-tagged | +Inquiry |
CD209-3034HF | Recombinant Full Length Human CD209 Protein, GST-tagged | +Inquiry |
CD209-726R | Recombinant Rhesus CD209 protein (Lys62-Glu381), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD209-2986HCL | Recombinant Human CD209 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD209 Products
Required fields are marked with *
My Review for All CD209 Products
Required fields are marked with *