Recombinant Full Length Human CD59 Protein, GST-tagged
Cat.No. : | CD59-3013HF |
Product Overview : | Human CD59 full-length ORF (NP_000602.1, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 128 amino acids |
Description : | This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 40.6 kDa |
AA Sequence : | MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ] |
Official Symbol | CD59 |
Synonyms | CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344), CD59 antigen, complement regulatory protein, MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.3A5; EJ16; EJ30; EL32; G344; p18 20; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); 1F5; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; HRF-20; MAC-IP; p18-20; MGC2354; FLJ38134; FLJ92039; |
Gene ID | 966 |
mRNA Refseq | NM_000611 |
Protein Refseq | NP_000602 |
MIM | 107271 |
UniProt ID | P13987 |
◆ Recombinant Proteins | ||
CD59-0955H | Recombinant Human CD59 Protein (Leu26-Asn102), GST tagged | +Inquiry |
CD59-5370H | Recombinant Human CD59 protein, His-tagged | +Inquiry |
CD59-3977H | Recombinant Human CD59, His tagged | +Inquiry |
CD59-3013HF | Recombinant Full Length Human CD59 Protein, GST-tagged | +Inquiry |
CD59-202H | Recombinant Human CD59 Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
CD59-1968HCL | Recombinant Human CD59 cell lysate | +Inquiry |
CD59-1365RCL | Recombinant Rat CD59 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD59 Products
Required fields are marked with *
My Review for All CD59 Products
Required fields are marked with *