Recombinant Full Length Human Cd82 Antigen(Cd82) Protein, His-Tagged
Cat.No. : | RFL30269HF |
Product Overview : | Recombinant Full Length Human CD82 antigen(CD82) Protein (P27701) (1-267aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-267) |
Form : | Lyophilized powder |
AA Sequence : | MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGI VTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKG EEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAI IELLGMVLSICLCRHVHSEDYSKVPKY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD82 |
Synonyms | CD82; KAI1; SAR2; ST6; TSPAN27; CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1; Suppressor of tumorigenicity 6 protein; Tetraspanin-27; Tspan-27; CD antigen CD82 |
UniProt ID | P27701 |
◆ Recombinant Proteins | ||
CD82-3969H | Recombinant Human CD82 protein(Gly111-Leu228), His-tagged | +Inquiry |
RFL2400MF | Recombinant Full Length Mouse Cd82 Antigen(Cd82) Protein, His-Tagged | +Inquiry |
CD82-3111M | Recombinant Mouse CD82 Protein | +Inquiry |
CD82-1848C | Recombinant Chicken CD82 | +Inquiry |
CD82-67HF | Recombinant Full Length Human CD82 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD82-1960HCL | Recombinant Human CD82 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD82 Products
Required fields are marked with *
My Review for All CD82 Products
Required fields are marked with *