Recombinant Full Length Human Cd99 Antigen(Cd99) Protein, His-Tagged
| Cat.No. : | RFL31233HF |
| Product Overview : | Recombinant Full Length Human CD99 antigen(CD99) Protein (P14209) (23-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (23-185) |
| Form : | Lyophilized powder |
| AA Sequence : | DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CD99 |
| Synonyms | CD99; MIC2; MIC2X; MIC2Y; CD99 antigen; 12E7; E2 antigen; Protein MIC2; T-cell surface glycoprotein E2; CD antigen CD99 |
| UniProt ID | P14209 |
| ◆ Recombinant Proteins | ||
| CD99-4548H | Recombinant Human CD99 Protein (Met1-Asp122), C-His tagged | +Inquiry |
| CD99-176H | Recombinant Human CD99 Protein, His-tagged | +Inquiry |
| CD99-589H | Active Recombinant Human CD99, Fc-tagged, Biotinylated | +Inquiry |
| CD99-6941H | Recombinant Human CD99 protein, His & T7-tagged | +Inquiry |
| CD99-665HF | Recombinant Full Length Human CD99 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD99-098HKCL | Human CD99 Knockdown Cell Lysate | +Inquiry |
| CD99-1360RCL | Recombinant Rat CD99 cell lysate | +Inquiry |
| CD99-2203MCL | Recombinant Mouse CD99 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD99 Products
Required fields are marked with *
My Review for All CD99 Products
Required fields are marked with *



