Recombinant Full Length Human CEACAM8 Protein, GST-tagged

Cat.No. : CEACAM8-3276HF
Product Overview : Human CEACAM8 full-length ORF (AAH26263, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 349 amino acids
Description : CEACAM8 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 8) is a Protein Coding gene. Diseases associated with CEACAM8 include Endocarditis and Shwartzman Phenomenon. Among its related pathways are Innate Immune System and Cell surface interactions at the vascular wall. An important paralog of this gene is CEACAM1.
Molecular Mass : 64.02 kDa
AA Sequence : MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ]
Official Symbol CEACAM8
Synonyms CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95;
Gene ID 1088
mRNA Refseq NM_001816
Protein Refseq NP_001807
MIM 615747
UniProt ID P31997

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM8 Products

Required fields are marked with *

My Review for All CEACAM8 Products

Required fields are marked with *

0
cart-icon
0
compare icon