Recombinant Full Length Human CEACAM8 Protein, GST-tagged
Cat.No. : | CEACAM8-3276HF |
Product Overview : | Human CEACAM8 full-length ORF (AAH26263, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 349 amino acids |
Description : | CEACAM8 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 8) is a Protein Coding gene. Diseases associated with CEACAM8 include Endocarditis and Shwartzman Phenomenon. Among its related pathways are Innate Immune System and Cell surface interactions at the vascular wall. An important paralog of this gene is CEACAM1. |
Molecular Mass : | 64.02 kDa |
AA Sequence : | MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ] |
Official Symbol | CEACAM8 |
Synonyms | CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95; |
Gene ID | 1088 |
mRNA Refseq | NM_001816 |
Protein Refseq | NP_001807 |
MIM | 615747 |
UniProt ID | P31997 |
◆ Recombinant Proteins | ||
CEACAM8-3233H | Recombinant Human CEACAM8 protein, His-tagged | +Inquiry |
CEACAM8-222H | Recombinant Human CEACAM8, C13&N15-labeled | +Inquiry |
CEACAM8-2984H | Active Recombinant Human CEACAM8 protein, His-tagged | +Inquiry |
CEACAM8-0849H | Recombinant Human CEACAM8 Protein (Gln35-Asp320), His tagged | +Inquiry |
CEACAM8-69HF | Recombinant Full Length Human CEACAM8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *