Recombinant Human CEACAM8 protein, T7/His-tagged

Cat.No. : CEACAM8-45H
Product Overview : Recombinant human CD67 extracellular domain cDNA (35 - 320 aa, derived from BC026263) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 35-320 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIG YVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNP VEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTL NVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSAT GRNRTTVRMITVSD
Purity : >90% by SDS-PAGE
Applications : 1. May be used coating matrix protein for in vitro granulocytes differentiation regulations study.2. May be used for protein-protein interaction assay development.3. Potential diagnostic biomarker protein for acute myolofibrosis.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ]
Official Symbol CEACAM8
Synonyms CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95;
Gene ID 1088
mRNA Refseq NM_001816
Protein Refseq NP_001807
MIM
UniProt ID P31997
Chromosome Location 19q13.2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM8 Products

Required fields are marked with *

My Review for All CEACAM8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon