Recombinant Full Length Human CEBPB Protein, GST-tagged
| Cat.No. : | CEBPB-3278HF | 
| Product Overview : | Human CEBPB full-length ORF (AAH21931.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 345 amino acids | 
| Description : | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013] | 
| Molecular Mass : | 62.5 kDa | 
| AA Sequence : | MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CEBPB CCAAT/enhancer binding protein (C/EBP), beta [ Homo sapiens ] | 
| Official Symbol | CEBPB | 
| Synonyms | CEBPB; CCAAT/enhancer binding protein (C/EBP), beta; TCF5; CCAAT/enhancer-binding protein beta; C/EBP beta; CRP2; IL6DBP; interleukin 6 dependent DNA binding protein; LAP; liver enriched transcriptional activator protein; NFIL6; nuclear factor of interleukin 6; TCF-5; nuclear factor NF-IL6; transcription factor 5; interleukin 6-dependent DNA-binding protein; liver-enriched transcriptional activator protein; NF-IL6; C/EBP-beta; MGC32080; | 
| Gene ID | 1051 | 
| mRNA Refseq | NM_005194 | 
| Protein Refseq | NP_005185 | 
| MIM | 189965 | 
| UniProt ID | P17676 | 
| ◆ Recombinant Proteins | ||
| Cebpb-876M | Recombinant Mouse Cebpb Protein, MYC/DDK-tagged | +Inquiry | 
| CEBPB-1249H | Recombinant Human CEBPB Protein (Met199-Cys345), N-His tagged | +Inquiry | 
| CEBPB-983R | Recombinant Rat CEBPB Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CEBPB-27010TH | Recombinant Human CEBPB, His-tagged | +Inquiry | 
| CEBPB-1325R | Recombinant Rat CEBPB Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CEBPB-7598HCL | Recombinant Human CEBPB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEBPB Products
Required fields are marked with *
My Review for All CEBPB Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            