Recombinant Full Length Human CFL2 Protein, GST-tagged
Cat.No. : | CFL2-3297HF |
Product Overview : | Human CFL2 full-length ORF (NP_068733.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 166 amino acids |
Description : | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFL2 cofilin 2 (muscle) [ Homo sapiens ] |
Official Symbol | CFL2 |
Synonyms | CFL2; cofilin 2 (muscle); cofilin-2; cofilin, muscle isoform; NEM7; |
Gene ID | 1073 |
mRNA Refseq | NM_001243645 |
Protein Refseq | NP_001230574 |
MIM | 601443 |
UniProt ID | Q9Y281 |
◆ Recombinant Proteins | ||
CFL2-1174H | Recombinant Human CFL2 Protein, GST-Tagged | +Inquiry |
CFL2-2466HF | Active Recombinant Full Length Human CFL2 Protein, GST-tagged | +Inquiry |
CFL2-26843TH | Recombinant Human CFL2, His-tagged | +Inquiry |
CFL2-1224C | Recombinant Chicken CFL2 | +Inquiry |
CFL2-3297HF | Recombinant Full Length Human CFL2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFL2 Products
Required fields are marked with *
My Review for All CFL2 Products
Required fields are marked with *
0
Inquiry Basket