Recombinant Full Length Human CLDN7 Protein, GST-tagged
Cat.No. : | CLDN7-2062HF |
Product Overview : | Human CLDN7 full-length ORF ( NP_001298.2, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 211 amino acids |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010] |
Molecular Mass : | 48.8 kDa |
AA Sequence : | MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLDN7 claudin 7 [ Homo sapiens ] |
Official Symbol | CLDN7 |
Synonyms | CLDN7; claudin 7; CEPTRL2, CPETRL2; claudin-7; Hs.84359; clostridium perfringens enterotoxin receptor-like 2; CLDN-7; CEPTRL2; CPETRL2; claudin-1 |
Gene ID | 1366 |
mRNA Refseq | NM_001185022 |
Protein Refseq | NP_001171951 |
MIM | 609131 |
UniProt ID | O95471 |
◆ Recombinant Proteins | ||
CLDN7-27069TH | Recombinant Human CLDN7 | +Inquiry |
CLDN7-028H | Recombinant Human CLDN7 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CLDN7-2062HF | Recombinant Full Length Human CLDN7 Protein, GST-tagged | +Inquiry |
RFL23007BF | Recombinant Full Length Bovine Claudin-7(Cldn7) Protein, His-Tagged | +Inquiry |
CLDN7-3541M | Recombinant Mouse CLDN7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN7-7459HCL | Recombinant Human CLDN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN7 Products
Required fields are marked with *
My Review for All CLDN7 Products
Required fields are marked with *
0
Inquiry Basket