Recombinant Human CLDN7
Cat.No. : | CLDN7-27069TH |
Product Overview : | Recombinant fragment of Human Claudin 7 (amino acids 31-81) with proprietary tag, predicted MW 31.24kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 51 amino acids |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found. |
Molecular Weight : | 31.240kDa inclusive of tags |
Tissue specificity : | Expressed in kidney, lung and prostate. Isoform 1 seems to be predominant, except in some normal prostate samples, where isoform 2 is the major form. Down-regulated in breast cancers, including ductal carcinoma in situ (DCIS), lobular carcinoma in situ (L |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATR |
Sequence Similarities : | Belongs to the claudin family. |
Gene Name | CLDN7 claudin 7 [ Homo sapiens ] |
Official Symbol | CLDN7 |
Synonyms | CLDN7; claudin 7; CEPTRL2, CPETRL2; claudin-7; Hs.84359; |
Gene ID | 1366 |
mRNA Refseq | NM_001185022 |
Protein Refseq | NP_001171951 |
MIM | 609131 |
Uniprot ID | O95471 |
Chromosome Location | 17 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | identical protein binding; protein binding; structural molecule activity; |
◆ Recombinant Proteins | ||
CLDN7-11299H | Recombinant Human CLDN7, GST-tagged | +Inquiry |
CLDN7-028H | Recombinant Human CLDN7 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CLDN7-3541M | Recombinant Mouse CLDN7 Protein | +Inquiry |
RFL23007BF | Recombinant Full Length Bovine Claudin-7(Cldn7) Protein, His-Tagged | +Inquiry |
CLDN7-1735M | Recombinant Mouse CLDN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN7-7459HCL | Recombinant Human CLDN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN7 Products
Required fields are marked with *
My Review for All CLDN7 Products
Required fields are marked with *