Recombinant Human CLDN7

Cat.No. : CLDN7-27069TH
Product Overview : Recombinant fragment of Human Claudin 7 (amino acids 31-81) with proprietary tag, predicted MW 31.24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 51 amino acids
Description : This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.
Molecular Weight : 31.240kDa inclusive of tags
Tissue specificity : Expressed in kidney, lung and prostate. Isoform 1 seems to be predominant, except in some normal prostate samples, where isoform 2 is the major form. Down-regulated in breast cancers, including ductal carcinoma in situ (DCIS), lobular carcinoma in situ (L
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATR
Sequence Similarities : Belongs to the claudin family.
Gene Name CLDN7 claudin 7 [ Homo sapiens ]
Official Symbol CLDN7
Synonyms CLDN7; claudin 7; CEPTRL2, CPETRL2; claudin-7; Hs.84359;
Gene ID 1366
mRNA Refseq NM_001185022
Protein Refseq NP_001171951
MIM 609131
Uniprot ID O95471
Chromosome Location 17
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function identical protein binding; protein binding; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN7 Products

Required fields are marked with *

My Review for All CLDN7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon