Recombinant Full Length Human CLEC2B Protein, GST-tagged
| Cat.No. : | CLEC2B-2132HF | 
| Product Overview : | Human CLEC2B full-length ORF ( AAH05254, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 149 amino acids | 
| Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 42.13 kDa | 
| AA Sequence : | MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CLEC2B C-type lectin domain family 2, member B [ Homo sapiens ] | 
| Official Symbol | CLEC2B | 
| Synonyms | CLEC2B; C-type lectin domain family 2, member B; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 2 (activation induced) , CLECSF2; C-type lectin domain family 2 member B; AICL; HP10085; activation-induced C-type lectin; C-type lectin superfamily member 2; IFN-alpha2b-inducing related protein 1; IFN-alpha-2b-inducing-related protein 1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced); IFNRG1; CLECSF2 | 
| Gene ID | 9976 | 
| mRNA Refseq | NM_005127 | 
| Protein Refseq | NP_005118 | 
| MIM | 603242 | 
| UniProt ID | Q92478 | 
| ◆ Recombinant Proteins | ||
| CLEC2B-2132HF | Recombinant Full Length Human CLEC2B Protein, GST-tagged | +Inquiry | 
| CLEC2B-1462H | Recombinant Human CLEC2B Protein, GST-tagged | +Inquiry | 
| CLEC2B-001H | Recombinant Human CLEC2B Protein, hIgG-His-tagged | +Inquiry | 
| CLEC2B-454H | Recombinant Human CLEC2B Protein, Fc-tagged | +Inquiry | 
| CLEC2B-730R | Recombinant Rhesus Macaque CLEC2B Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CLEC2B-7452HCL | Recombinant Human CLEC2B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC2B Products
Required fields are marked with *
My Review for All CLEC2B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            