Recombinant Human CLEC2B Protein, GST-tagged
Cat.No. : | CLEC2B-1462H |
Product Overview : | Human CLEC2B full-length ORF ( AAH05254, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 42.13 kDa |
AA Sequence : | MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC2B C-type lectin domain family 2, member B [ Homo sapiens ] |
Official Symbol | CLEC2B |
Synonyms | CLEC2B; C-type lectin domain family 2, member B; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 2 (activation induced) , CLECSF2; C-type lectin domain family 2 member B; AICL; HP10085; activation-induced C-type lectin; C-type lectin superfamily member 2; IFN-alpha2b-inducing related protein 1; IFN-alpha-2b-inducing-related protein 1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced); IFNRG1; CLECSF2; |
Gene ID | 9976 |
mRNA Refseq | NM_005127 |
Protein Refseq | NP_005118 |
MIM | 603242 |
UniProt ID | Q92478 |
◆ Recombinant Proteins | ||
CLEC2B-730R | Recombinant Rhesus Macaque CLEC2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC2B-7120H | Recombinant Human CLEC2B, His-tagged | +Inquiry |
CLEC2B-454H | Recombinant Human CLEC2B Protein, Fc-tagged | +Inquiry |
CLEC2B-1462H | Recombinant Human CLEC2B Protein, GST-tagged | +Inquiry |
CLEC2B-905R | Recombinant Rhesus monkey CLEC2B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC2B-7452HCL | Recombinant Human CLEC2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC2B Products
Required fields are marked with *
My Review for All CLEC2B Products
Required fields are marked with *