Recombinant Full Length Human CLEC7A Protein, GST-tagged

Cat.No. : CLEC7A-2172HF
Product Overview : Human CLEC7A full-length ORF ( AAH13385, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 77 amino acids
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.21 kDa
AA Sequence : MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC7A C-type lectin domain family 7, member A [ Homo sapiens ]
Official Symbol CLEC7A
Synonyms CLEC7A; C-type lectin domain family 7, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12 , CLECSF12; C-type lectin domain family 7 member A; dectin 1; hDectin 1; dectin-1; beta-glucan receptor; lectin-like receptor 1; DC-associated C-type lectin 1; C-type lectin superfamily member 12; dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; BGR; CANDF4; DECTIN1; CLECSF12
Gene ID 64581
mRNA Refseq NM_022570
Protein Refseq NP_072092
MIM 606264
UniProt ID Q9BXN2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC7A Products

Required fields are marked with *

My Review for All CLEC7A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon