Recombinant Human CLEC7A Protein, GST-tagged
Cat.No. : | CLEC7A-1473H |
Product Overview : | Human CLEC7A full-length ORF ( AAH13385, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.21 kDa |
AA Sequence : | MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC7A C-type lectin domain family 7, member A [ Homo sapiens ] |
Official Symbol | CLEC7A |
Synonyms | CLEC7A; C-type lectin domain family 7, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12 , CLECSF12; C-type lectin domain family 7 member A; dectin 1; hDectin 1; dectin-1; beta-glucan receptor; lectin-like receptor 1; DC-associated C-type lectin 1; C-type lectin superfamily member 12; dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; BGR; CANDF4; DECTIN1; CLECSF12; |
Gene ID | 64581 |
mRNA Refseq | NM_022570 |
Protein Refseq | NP_072092 |
MIM | 606264 |
UniProt ID | Q9BXN2 |
◆ Recombinant Proteins | ||
CLEC7A-0624H | Recombinant Human CLEC7A Protein (T66-M247), His tagged | +Inquiry |
CLEC7A-732R | Recombinant Rhesus Macaque CLEC7A Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC7A-260H | Recombinant Human CLEC7A | +Inquiry |
CLEC7A-1691M | Recombinant Mouse CLEC7A protein, hFc-tagged | +Inquiry |
CLEC7A-130H | Recombinant Human CLEC7A Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC7A-001HCL | Recombinant Human CLEC7A cell lysate | +Inquiry |
CLEC7A-2455MCL | Recombinant Mouse CLEC7A cell lysate | +Inquiry |
CLEC7A-760HCL | Recombinant Human CLEC7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC7A Products
Required fields are marked with *
My Review for All CLEC7A Products
Required fields are marked with *