Recombinant Full Length Human CLPP Protein, GST-tagged
Cat.No. : | CLPP-1887HF |
Product Overview : | Human CLPP full-length ORF ( NP_006003.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 277 amino acids |
Description : | The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLPP ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) [ Homo sapiens ] |
Official Symbol | CLPP |
Synonyms | CLPP; ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli); ClpP (caseinolytic protease, ATP dependent, proteolytic subunit, E. coli) homolog , ClpP caseinolytic protease, ATP dependent, proteolytic subunit homolog (E. coli); putative ATP-dependent Clp protease proteolytic subunit, mitochondrial; ATP dependent protease ClpAP (E. coli); proteolytic subunit; human; endopeptidase Clp; ATP-dependent protease ClpAP, proteolytic subunit, human; ClpP caseinolytic peptidase ATP-dependent, proteolytic subunit; ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog |
Gene ID | 8192 |
mRNA Refseq | NM_006012 |
Protein Refseq | NP_006003 |
MIM | 601119 |
UniProt ID | Q16740 |
◆ Recombinant Proteins | ||
CLPP-1679H | Recombinant Human Clpp Caseinolytic Peptidase, ATP-Dependent, Proteolytic Subunit Homolog (E.coli) | +Inquiry |
CLPP-1766M | Recombinant Mouse CLPP Protein, His (Fc)-Avi-tagged | +Inquiry |
CLPP-3538H | Recombinant Human CLPP, His-tagged | +Inquiry |
CLPP-1887HF | Recombinant Full Length Human CLPP Protein, GST-tagged | +Inquiry |
CLPP-3599M | Recombinant Mouse CLPP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLPP-7434HCL | Recombinant Human CLPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLPP Products
Required fields are marked with *
My Review for All CLPP Products
Required fields are marked with *