Recombinant Full Length Human CNOT4 Protein, GST-tagged

Cat.No. : CNOT4-1938HF
Product Overview : Human CNOT4 full-length ORF (BAC11125.1, 1 a.a. - 565 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 565 amino acids
Description : The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010]
Molecular Mass : 88.1 kDa
AA Sequence : MQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVADNSSSIESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSWDSPGSWTDPAIITGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPQIYYRVQHWTAIRQRGATIRKCRICPTLFSPSQPTTHSSLLISYVLKNPVPDQFFFSLTPDAMRSQGHYHLFINCKNFC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNOT4 CCR4-NOT transcription complex, subunit 4 [ Homo sapiens ]
Official Symbol CNOT4
Synonyms CNOT4; CCR4-NOT transcription complex, subunit 4; NOT4; CCR4-NOT transcription complex subunit 4; CLONE243; NOT4H; CCR4-associated factor 4; E3 ubiquitin-protein ligase CNOT4; potential transcriptional repressor NOT4Hp; NOT4 (negative regulator of transcription 4, yeast) homolog
Gene ID 4850
mRNA Refseq NM_001008225
Protein Refseq NP_001008226
MIM 604911
UniProt ID O95628

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNOT4 Products

Required fields are marked with *

My Review for All CNOT4 Products

Required fields are marked with *

0
cart-icon