Recombinant Full Length Human CNOT4 Protein, GST-tagged
| Cat.No. : | CNOT4-1938HF | 
| Product Overview : | Human CNOT4 full-length ORF (BAC11125.1, 1 a.a. - 565 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 565 amino acids | 
| Description : | The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] | 
| Molecular Mass : | 88.1 kDa | 
| AA Sequence : | MQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVADNSSSIESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSWDSPGSWTDPAIITGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPQIYYRVQHWTAIRQRGATIRKCRICPTLFSPSQPTTHSSLLISYVLKNPVPDQFFFSLTPDAMRSQGHYHLFINCKNFC | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CNOT4 CCR4-NOT transcription complex, subunit 4 [ Homo sapiens ] | 
| Official Symbol | CNOT4 | 
| Synonyms | CNOT4; CCR4-NOT transcription complex, subunit 4; NOT4; CCR4-NOT transcription complex subunit 4; CLONE243; NOT4H; CCR4-associated factor 4; E3 ubiquitin-protein ligase CNOT4; potential transcriptional repressor NOT4Hp; NOT4 (negative regulator of transcription 4, yeast) homolog | 
| Gene ID | 4850 | 
| mRNA Refseq | NM_001008225 | 
| Protein Refseq | NP_001008226 | 
| MIM | 604911 | 
| UniProt ID | O95628 | 
| ◆ Recombinant Proteins | ||
| CNOT4-1582H | Recombinant Human CNOT4 Protein, GST-tagged | +Inquiry | 
| CNOT4-6755H | Recombinant Human CNOT4 protein, His-tagged | +Inquiry | 
| CNOT4-2039C | Recombinant Chicken CNOT4 | +Inquiry | 
| Cnot4-2221M | Recombinant Mouse Cnot4 Protein, Myc/DDK-tagged | +Inquiry | 
| CNOT4-1938HF | Recombinant Full Length Human CNOT4 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CNOT4-7400HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry | 
| CNOT4-7401HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT4 Products
Required fields are marked with *
My Review for All CNOT4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            