Recombinant Human CNOT4 protein, His-tagged
| Cat.No. : | CNOT4-6755H |
| Product Overview : | Recombinant Human CNOT4 protein(331-476 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 331-476 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | QSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CNOT4 CCR4-NOT transcription complex, subunit 4 [ Homo sapiens ] |
| Official Symbol | CNOT4 |
| Synonyms | CNOT4; CCR4-NOT transcription complex, subunit 4; NOT4; CCR4-NOT transcription complex subunit 4; CLONE243; NOT4H; CCR4-associated factor 4; E3 ubiquitin-protein ligase CNOT4; potential transcriptional repressor NOT4Hp; NOT4 (negative regulator of transcription 4, yeast) homolog; |
| Gene ID | 4850 |
| mRNA Refseq | NM_001008225 |
| Protein Refseq | NP_001008226 |
| MIM | 604911 |
| UniProt ID | O95628 |
| ◆ Recombinant Proteins | ||
| CNOT4-2039C | Recombinant Chicken CNOT4 | +Inquiry |
| CNOT4-1582H | Recombinant Human CNOT4 Protein, GST-tagged | +Inquiry |
| CNOT4-1938HF | Recombinant Full Length Human CNOT4 Protein, GST-tagged | +Inquiry |
| Cnot4-2221M | Recombinant Mouse Cnot4 Protein, Myc/DDK-tagged | +Inquiry |
| CNOT4-6755H | Recombinant Human CNOT4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNOT4-7400HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry |
| CNOT4-7401HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT4 Products
Required fields are marked with *
My Review for All CNOT4 Products
Required fields are marked with *
