Recombinant Full Length Human CNOT7 Protein, GST-tagged
| Cat.No. : | CNOT7-1941HF |
| Product Overview : | Human CNOT7 full-length ORF ( AAH60852, 1 a.a. - 285 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 285 amino acids |
| Description : | The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The encoded protein downregulates the innate immune response and therefore provides a therapeutic target for enhancing its antimicrobial activity against foreign agents. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Apr 2016] |
| Molecular Mass : | 57.09 kDa |
| AA Sequence : | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNOT7 CCR4-NOT transcription complex, subunit 7 [ Homo sapiens ] |
| Official Symbol | CNOT7 |
| Synonyms | CNOT7; CCR4-NOT transcription complex, subunit 7; CAF1; CCR4-NOT transcription complex subunit 7; BTG1 binding factor 1; CAF-1; BTG1-binding factor 1; CCR4-associated factor 1; carbon catabolite repressor protein (CCR4)-associative factor 1; hCAF-1 |
| Gene ID | 29883 |
| mRNA Refseq | NM_013354 |
| Protein Refseq | NP_037486 |
| MIM | 604913 |
| UniProt ID | Q9UIV1 |
| ◆ Recombinant Proteins | ||
| CNOT7-1793H | Recombinant Human CNOT7 protein, GST-tagged | +Inquiry |
| Cnot7-2223M | Recombinant Mouse Cnot7 Protein, Myc/DDK-tagged | +Inquiry |
| Cnot7-7306M | Recombinant Mouse Cnot7 Protein, His-tagged | +Inquiry |
| CNOT7-766R | Recombinant Rhesus Macaque CNOT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNOT7-4189H | Recombinant Human CNOT7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNOT7-7399HCL | Recombinant Human CNOT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT7 Products
Required fields are marked with *
My Review for All CNOT7 Products
Required fields are marked with *
