Recombinant Full Length Schizosaccharomyces Pombe Cytochrome Oxidase Assembly Protein 1(Coa1) Protein, His-Tagged
Cat.No. : | RFL9639SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Cytochrome oxidase assembly protein 1(coa1) Protein (O14320) (1-249aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-249) |
Form : | Lyophilized powder |
AA Sequence : | MISSKSLDYTRFLPFFAALVRGHCLTVKSPTHNCGSGVKTIMDKSSIFLKNRYPISINRF VQQRKTFCGASVCLHKVLVQRQFGFEEKSHGLKYKKLFRRNIGTSEKKNRLPDLLELSSS PRRLPILFAAFCLLWGTCAVLAIQYGKQNSNVTQVVMYRVQHSKEAQDLLGSNIDFKYPF PWVPGKLHKRQGFIDINFEVSGSLASGTVHYQSQRFGPIAHWVELDCTLTSNGKTIKIPT GVSKDTQWT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | coa1 |
Synonyms | coa1; SPBC16E9.03c; Cytochrome c oxidase assembly factor 1 |
UniProt ID | O14320 |
◆ Recombinant Proteins | ||
COA1-2708H | Recombinant Human COA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COA1-371H | Recombinant Human COA1 Protein (38-146 aa), GST-tagged | +Inquiry |
COA1-4224H | Recombinant Human COA1 Protein, GST-tagged | +Inquiry |
COA1-1252H | Recombinant Human COA1 | +Inquiry |
RFL9639SF | Recombinant Full Length Schizosaccharomyces Pombe Cytochrome Oxidase Assembly Protein 1(Coa1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COA1-628HCL | Recombinant Human COA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All coa1 Products
Required fields are marked with *
My Review for All coa1 Products
Required fields are marked with *