Recombinant Full Length Human COMMD6 Protein, Flag tagged

• Cat.No.: COMMD6-08HFL
• Product Overview: Recombinant protein of human COMM domain containing 6 (COMMD6), transcript variant 2 with C-Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-85 aa
• Description: COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 9.5 kDa
• AASequence: MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: >0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: COMMD6 COMM domain containing 6 [ Homo sapiens (human) ]
• Official Symbol: COMMD6
• Synonyms: COMMD6; COMM domain containing 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog
• Gene ID: 170622
• mRNA Refseq: NM_203495
• Protein Refseq: NP_987091
• MIM: 612377
• UniProt ID: Q7Z4G1