Recombinant Full Length Human CRMP1 Protein, C-Flag-tagged
Cat.No. : | CRMP1-524HFL |
Product Overview : | Recombinant Full Length Human CRMP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62 kDa |
AA Sequence : | MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGI DVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVD ITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQK RILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIA ASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTL IPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFG LQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVA PPGGRSNITSLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CRMP1 collapsin response mediator protein 1 [ Homo sapiens (human) ] |
Official Symbol | CRMP1 |
Synonyms | DRP1; DRP-1; CRMP-1; DPYSL1; ULIP-3 |
Gene ID | 1400 |
mRNA Refseq | NM_001313.5 |
Protein Refseq | NP_001304.1 |
MIM | 602462 |
UniProt ID | Q14194 |
◆ Recombinant Proteins | ||
Crmp1-2316M | Recombinant Mouse Crmp1 Protein, Myc/DDK-tagged | +Inquiry |
CRMP1-662H | Recombinant Human CRMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRMP1-1662H | Recombinant Full Length Human CRMP1 Protein (1-572 aa) | +Inquiry |
CRMP1-524HFL | Recombinant Full Length Human CRMP1 Protein, C-Flag-tagged | +Inquiry |
CRMP1-11585H | Recombinant Human CRMP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRMP1-7273HCL | Recombinant Human CRMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRMP1 Products
Required fields are marked with *
My Review for All CRMP1 Products
Required fields are marked with *
0
Inquiry Basket