Recombinant Full Length Human CROT Protein, C-Flag-tagged
Cat.No. : | CROT-1243HFL |
Product Overview : | Recombinant Full Length Human CROT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 70 kDa |
AA Sequence : | MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKL LERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWHNLNYWQLLR KEKVPVHKVGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFRTESEGRSPNHIVVLCRGRAFVFDVIHEGC LVTPPELLRQLTYIHKKCHSEPDGPGIAALTSEERTRWAKAREYLIGLDPENLALLEKIQSSLLVYSMED SSPHVTPEDYSEIIAAILIGDPTVRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNE GRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLREASDLQIAAYAFTSFGKKLTKNKMLHPDTFI QLALQLAYYRLHGHPGCCYETAMTRHFYHGRTETMRSCTVEAVRWCQSMQDPSVNLRERQQKMLQAFAKH NKMMKDCSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFVLSTSLVGYLRVQGVVVPMVH NGYGFFYHIRDDRFVVACSAWKSCPETDAEKLVQLTFCAFHDMIQLMNSTHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | CROT carnitine O-octanoyltransferase [ Homo sapiens (human) ] |
Official Symbol | CROT |
Synonyms | COT |
Gene ID | 54677 |
mRNA Refseq | NM_021151.4 |
Protein Refseq | NP_066974.2 |
MIM | 606090 |
UniProt ID | Q9UKG9 |
◆ Recombinant Proteins | ||
CROT-1988M | Recombinant Mouse CROT Protein, His (Fc)-Avi-tagged | +Inquiry |
CROT-1243HFL | Recombinant Full Length Human CROT Protein, C-Flag-tagged | +Inquiry |
CROT-663H | Recombinant Human CROT Protein, His (Fc)-Avi-tagged | +Inquiry |
CROT-2148H | Recombinant Human CROT Protein (Lys410-Leu612), N-His tagged | +Inquiry |
CROT-2507H | Recombinant Human CROT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CROT-516HCL | Recombinant Human CROT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CROT Products
Required fields are marked with *
My Review for All CROT Products
Required fields are marked with *
0
Inquiry Basket