Recombinant Full Length Human CRYAB Protein, GST-tagged
| Cat.No. : | CRYAB-2128HF |
| Product Overview : | Human CRYAB full-length ORF ( AAH07008, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 175 amino acids |
| Description : | Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
| Molecular Mass : | 44.99 kDa |
| AA Sequence : | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRYAB crystallin, alpha B [ Homo sapiens ] |
| Official Symbol | CRYAB |
| Synonyms | CRYAB; crystallin, alpha B; CRYA2; alpha-crystallin B chain; HSPB5; heat shock protein beta-5; rosenthal fiber component; heat-shock 20 kD like-protein; renal carcinoma antigen NY-REN-27; CTPP2 |
| Gene ID | 1410 |
| mRNA Refseq | NM_001885 |
| Protein Refseq | NP_001876 |
| MIM | 123590 |
| UniProt ID | P02511 |
| ◆ Recombinant Proteins | ||
| CRYAB-01H | Recombinant Human CRYAB Protein, Myc/DDK-tagged | +Inquiry |
| CRYAB-3827H | Recombinant Human CRYAB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CRYAB-668H | Recombinant Human CRYAB Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cryab-002M | Recombinant Mouse Cryab Protein | +Inquiry |
| CRYAB-31725TH | Recombinant Human CRYAB, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CRYAB-06B | Native Bovine αB-Crystallin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRYAB-7266HCL | Recombinant Human CRYAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYAB Products
Required fields are marked with *
My Review for All CRYAB Products
Required fields are marked with *
