Recombinant Human CRYAB protein, His-SUMO-tagged
| Cat.No. : | CRYAB-2734H |
| Product Overview : | Recombinant Human CRYAB protein(P02511)(1-175aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-175aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.2 kDa |
| AA Sequence : | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CRYAB crystallin, alpha B [ Homo sapiens ] |
| Official Symbol | CRYAB |
| Synonyms | CRYAB; crystallin, alpha B; CRYA2; alpha-crystallin B chain; HSPB5; heat shock protein beta-5; rosenthal fiber component; heat-shock 20 kD like-protein; renal carcinoma antigen NY-REN-27; CTPP2; |
| Gene ID | 1410 |
| mRNA Refseq | NM_001885 |
| Protein Refseq | NP_001876 |
| MIM | 123590 |
| UniProt ID | P02511 |
| ◆ Recombinant Proteins | ||
| CRYAB-2734H | Recombinant Human CRYAB protein, His-SUMO-tagged | +Inquiry |
| CRYAB-170C | Recombinant Cynomolgus Monkey CRYAB Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRYAB-2128HF | Recombinant Full Length Human CRYAB Protein, GST-tagged | +Inquiry |
| CRYAB-1822H | Recombinant Human CRYAB Protein (Met1-Lys175), N-His tagged | +Inquiry |
| CRYAB-1037R | Recombinant Rhesus monkey CRYAB Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CRYAB-06B | Native Bovine αB-Crystallin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRYAB-7266HCL | Recombinant Human CRYAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYAB Products
Required fields are marked with *
My Review for All CRYAB Products
Required fields are marked with *
