Recombinant Human CRYAB protein, His-SUMO-tagged
Cat.No. : | CRYAB-2734H |
Product Overview : | Recombinant Human CRYAB protein(P02511)(1-175aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-175aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.2 kDa |
AA Sequence : | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CRYAB crystallin, alpha B [ Homo sapiens ] |
Official Symbol | CRYAB |
Synonyms | CRYAB; crystallin, alpha B; CRYA2; alpha-crystallin B chain; HSPB5; heat shock protein beta-5; rosenthal fiber component; heat-shock 20 kD like-protein; renal carcinoma antigen NY-REN-27; CTPP2; |
Gene ID | 1410 |
mRNA Refseq | NM_001885 |
Protein Refseq | NP_001876 |
MIM | 123590 |
UniProt ID | P02511 |
◆ Recombinant Proteins | ||
Cryab-2326M | Recombinant Mouse Cryab Protein, Myc/DDK-tagged | +Inquiry |
CRYAB-668H | Recombinant Human CRYAB Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYAB-3934M | Recombinant Mouse CRYAB Protein | +Inquiry |
CRYAB-1820H | Recombinant Human CRYAB Protein (Met1-Lys175), C-His tagged | +Inquiry |
CRYAB-27293TH | Recombinant Human CRYAB | +Inquiry |
◆ Native Proteins | ||
CRYAB-06B | Native Bovine αB-Crystallin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYAB-7266HCL | Recombinant Human CRYAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYAB Products
Required fields are marked with *
My Review for All CRYAB Products
Required fields are marked with *