Recombinant Full Length Human CTBP2 Protein, C-Flag-tagged
Cat.No. : | CTBP2-673HFL |
Product Overview : | Recombinant Full Length Human CTBP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.8 kDa |
AA Sequence : | MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV AHPSQAPSPNQPTKHGDNREHPNEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency, Stem cell relevant signaling - Wnt Signaling pathway |
Protein Pathways : | Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | CTBP2 C-terminal binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | CTBP2 |
Synonyms | C-terminal binding protein 2; OTTHUMP00000020699; OTTHUMP00000020701; ribeye |
Gene ID | 1488 |
mRNA Refseq | NM_001329.4 |
Protein Refseq | NP_001320.1 |
MIM | 602619 |
UniProt ID | P56545 |
◆ Recombinant Proteins | ||
CTBP2-4010M | Recombinant Mouse CTBP2 Protein | +Inquiry |
Ctbp2-2352M | Recombinant Mouse Ctbp2 Protein, Myc/DDK-tagged | +Inquiry |
CTBP2-1308R | Recombinant Rat CTBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTBP2-4647H | Recombinant Human CTBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTBP2-1649R | Recombinant Rat CTBP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTBP2-417HCL | Recombinant Human CTBP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTBP2 Products
Required fields are marked with *
My Review for All CTBP2 Products
Required fields are marked with *
0
Inquiry Basket