Recombinant Full Length Human CTDSPL Protein, GST-tagged

• Cat.No.: CTDSPL-2269HF
• Product Overview: Human CTDSPL full-length ORF ( NP_005799.2, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 265 amino acids
• Description: CTDSPL (CTD Small Phosphatase Like) is a Protein Coding gene. Among its related pathways are Regulation of cytoplasmic and nuclear SMAD2/3 signaling and Signaling by BMP. GO annotations related to this gene include phosphatase activity and phosphoprotein phosphatase activity. An important paralog of this gene is CTDSP1.
• Molecular Mass: 56.3 kDa
• AA Sequence: MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTDSPL CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like [ Homo sapiens ]
• Official Symbol: CTDSPL
• Synonyms: CTDSPL; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like; C3orf8, chromosome 3 open reading frame 8; CTD small phosphatase-like protein; HYA22; HYA22 protein; PSR1; RB protein serine phosphatase from chromosome 3; RBSP3; SCP3; small CTD phosphatase 3; CTDSP-like; NIF-like protein; NLI-interacting factor 1; small C-terminal domain phosphatase 3; nuclear LIM interactor-interacting factor 1; carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3; C3orf8
• Gene ID: 10217
• mRNA Refseq: NM_001008392
• Protein Refseq: NP_001008393
• MIM: 608592
• UniProt ID: O15194