Recombinant Full Length Human CTSD Protein, GST-tagged
| Cat.No. : | CTSD-2341HF |
| Product Overview : | Human CTSD full-length ORF ( AAH16320, 26 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 412 amino acids |
| Description : | This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 71.06 kDa |
| AA Sequence : | LHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CTSD cathepsin D [ Homo sapiens ] |
| Official Symbol | CTSD |
| Synonyms | CTSD; cathepsin D; cathepsin D (lysosomal aspartyl protease) , CPSD; ceroid lipofuscinosis; neuronal 10; CLN10; lysosomal aspartyl protease; lysosomal aspartyl peptidase; ceroid-lipofuscinosis, neuronal 10; CPSD; MGC2311; |
| Gene ID | 1509 |
| mRNA Refseq | NM_001909 |
| Protein Refseq | NP_001900 |
| MIM | 116840 |
| UniProt ID | P07339 |
| ◆ Recombinant Proteins | ||
| CTSD-26213TH | Recombinant Human CTSD | +Inquiry |
| CTSD-2341HF | Recombinant Full Length Human CTSD Protein, GST-tagged | +Inquiry |
| CTSD-522H | Recombinant Human CTSD protein, His-tagged | +Inquiry |
| CTSD-218H | Recombinant Human CTSD, His-tagged | +Inquiry |
| CTSD-4669H | Recombinant Human CTSD protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
| CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
| CTSD-27858TH | Native Human CTSD | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSD-130HKCL | Human CTSD Knockdown Cell Lysate | +Inquiry |
| CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
| CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *



