Recombinant Full Length Human CTSD Protein, GST-tagged
Cat.No. : | CTSD-2341HF |
Product Overview : | Human CTSD full-length ORF ( AAH16320, 26 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 412 amino acids |
Description : | This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 71.06 kDa |
AA Sequence : | LHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSD cathepsin D [ Homo sapiens ] |
Official Symbol | CTSD |
Synonyms | CTSD; cathepsin D; cathepsin D (lysosomal aspartyl protease) , CPSD; ceroid lipofuscinosis; neuronal 10; CLN10; lysosomal aspartyl protease; lysosomal aspartyl peptidase; ceroid-lipofuscinosis, neuronal 10; CPSD; MGC2311; |
Gene ID | 1509 |
mRNA Refseq | NM_001909 |
Protein Refseq | NP_001900 |
MIM | 116840 |
UniProt ID | P07339 |
◆ Recombinant Proteins | ||
Ctsd-4222R | Recombinant Rat Ctsd protein, His&Myc-tagged | +Inquiry |
CTSD-522H | Recombinant Human CTSD protein, His-tagged | +Inquiry |
CTSD-9232Z | Recombinant Zebrafish CTSD | +Inquiry |
CTSD-6732C | Recombinant Chicken CTSD | +Inquiry |
CTSD-2752H | Recombinant Human CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *
0
Inquiry Basket