Recombinant Human CTSD protein, His-tagged
Cat.No. : | CTSD-4669H |
Product Overview : | Recombinant Human CTSD protein(P07339)(21-412 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-412 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 44.6 kDa |
AASequence : | LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | CTSD cathepsin D [ Homo sapiens ] |
Official Symbol | CTSD |
Synonyms | CTSD; cathepsin D; cathepsin D (lysosomal aspartyl protease) , CPSD; ceroid lipofuscinosis; neuronal 10; CLN10; lysosomal aspartyl protease; lysosomal aspartyl peptidase; ceroid-lipofuscinosis, neuronal 10; CPSD; MGC2311; |
Gene ID | 1509 |
mRNA Refseq | NM_001909 |
Protein Refseq | NP_001900 |
MIM | 116840 |
UniProt ID | P07339 |
◆ Recombinant Proteins | ||
CTSD-2758H | Recombinant Human CTSD protein, GST-tagged | +Inquiry |
CTSD-11684H | Recombinant Human CTSD, GST-tagged | +Inquiry |
CTSD-2752H | Recombinant Human CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSD-913R | Recombinant Rhesus Macaque CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSD-429C | Recombinant Cynomolgus CTSD Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-27858TH | Native Human CTSD | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *