Recombinant Full Length Human CX3CR1 Protein
| Cat.No. : | CX3CR1-103HF |
| Product Overview : | Recombinant full length Human CX3CR1 protein with a proprietary tag; predicted mwt: 65.12 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 355 amino acids |
| Description : | Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 65.120kDa |
| AA Sequence : | MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | Constituents: 0.79% Tris HCl, 0.31% Glutathione. Note: Reduced Glutathione. |
| Gene Name | CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ] |
| Official Symbol | CX3CR1 |
| Synonyms | CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28 |
| Gene ID | 1524 |
| mRNA Refseq | NM_001171171 |
| Protein Refseq | NP_001164642 |
| MIM | 601470 |
| UniProt ID | P49238 |
| ◆ Recombinant Proteins | ||
| RFL16386RF | Recombinant Full Length Rat Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
| CX3CR1-1343R | Recombinant Rat CX3CR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL26922BF | Recombinant Full Length Bovine Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
| RFL26790MF | Recombinant Full Length Mouse Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
| CX3CR1-28062TH | Recombinant Human CX3CR1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CX3CR1-7173HCL | Recombinant Human CX3CR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CX3CR1 Products
Required fields are marked with *
My Review for All CX3CR1 Products
Required fields are marked with *
